Cmv Monoclonal

Monoclonal antibody for SUR1 and SUR2B

SMC-432D 0.1mg
EUR 423.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated.

Cytomegalovirus Monoclonal Laboratories manufactures the cmv monoclonal reagents distributed by Genprice. The Cmv Monoclonal reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact cytomegalovirus monoclonal. Other Cmv products are available in stock. Specificity: Cmv Category: Monoclonal

True Blue Chloride

100mg
EUR 11200
Description: 71431-30-6

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 423.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 480
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 390.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 488.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 565.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 594.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 633.

Test Assays information

Monoclonal TBP monoclonal antibody

APR13720G 0.1ml
EUR 633.6
Description: A Monoclonal antibody against Human TBP monoclonal. The antibodies are raised in Mouse. This antibody is applicable in WB

Monoclonal EZH2 monoclonal antibody

AMM00030G 0.05mg
EUR 633.6
Description: A Monoclonal antibody against Human EZH2 monoclonal. The antibodies are raised in Mouse.

Monoclonal Rsf1 monoclonal antibody

AMM07673G 0.05mg
EUR 633.6
Description: A Monoclonal antibody against Human Rsf1 monoclonal. The antibodies are raised in Mouse. This antibody is applicable in WB and IF, IP

Monoclonal Rsf1 monoclonal antibody

AMM07674G 0.1ml
EUR 633.6
Description: A Monoclonal antibody against Human Rsf1 monoclonal. The antibodies are raised in Mouse. This antibody is applicable in WB and IF, IP

Monoclonal SirT1 monoclonal antibody

APR09951G 0.05mg
EUR 580.8
Description: A Monoclonal antibody against Human SirT1 monoclonal. The antibodies are raised in Mouse. This antibody is applicable in WB

Monoclonal SirT1 monoclonal antibody

APR09952G 0.1ml
EUR 580.8
Description: A Monoclonal antibody against Human SirT1 monoclonal. The antibodies are raised in Mouse. This antibody is applicable in WB

Monoclonal HDAC2 monoclonal antibody

AMM00031G 0.05mg
EUR 633.6
Description: A Monoclonal antibody against Human HDAC2 monoclonal. The antibodies are raised in Mouse. This antibody is applicable in WB and IF

Cytomegalovirus / CMV Early Antigen mouse monoclonal antibody, clone 1/42, Purified

AM05468PU-N 200 µg Ask for price

Monoclonal ER alpha monoclonal antibody

AMM00027G 0.1ml
EUR 633.6
Description: A Monoclonal antibody against Human ER alpha monoclonal. The antibodies are raised in Mouse. This antibody is applicable in WB, IC, E, IP, GS

Monoclonal ER alpha monoclonal antibody

AMM00028G 0.05mg
EUR 633.6
Description: A Monoclonal antibody against Human ER alpha monoclonal. The antibodies are raised in Mouse. This antibody is applicable in WB

Mouse Monoclonal KLF4 Monoclonal Antibody

TA326714 100 µg Ask for price

Mouse Monoclonal KLF4 Monoclonal Antibody

TA326715 100 µg Ask for price

Mouse Monoclonal Lin28 Monoclonal Antibody

TA326716 100 µg Ask for price

Monoclonal RbAp 46/48 monoclonal antibody

AMM00032G 0.1ml
EUR 580.8
Description: A Monoclonal antibody against Human RbAp 46/48 monoclonal. The antibodies are raised in Mouse. This antibody is applicable in WB

Monoclonal RbAp 46/48 monoclonal antibody

AMM00033G 0.05mg
EUR 580.8
Description: A Monoclonal antibody against Human RbAp 46/48 monoclonal. The antibodies are raised in Mouse. This antibody is applicable in WB

Cytomegalovirus / CMV Late Antigen (65 kDa) mouse monoclonal antibody, clone 0896, Purified

AM05719PU-N 100 µg Ask for price

Cytomegalovirus / CMV Late Antigen (65 kDa) mouse monoclonal antibody, clone 981, Purified

BM3129 1 mg Ask for price