Monoclonal antibody for SUR1 and SUR2B |
|
SMC-432D |
Stressmarq |
0.1mg |
EUR 423.6 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated. |
Cytomegalovirus Monoclonal Laboratories manufactures the cmv monoclonal reagents distributed by Genprice. The Cmv Monoclonal reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact cytomegalovirus monoclonal. Other Cmv products are available in stock. Specificity: Cmv Category: Monoclonal
Monoclonal antibody for SUR1 and SUR2B |
|
Stressmarq |
0.1mg |
EUR 423.6 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated. |
Monoclonal antibody for SUR1 and SUR2B |
|
Stressmarq |
0.1mg |
EUR 480 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 390. |
Monoclonal antibody for SUR1 and SUR2B |
|
Stressmarq |
0.1mg |
EUR 478.8 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 488. |
Monoclonal antibody for SUR1 and SUR2B |
|
Stressmarq |
0.1mg |
EUR 478.8 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 565. |
Monoclonal antibody for SUR1 and SUR2B |
|
Stressmarq |
0.1mg |
EUR 478.8 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 594. |
Monoclonal antibody for SUR1 and SUR2B |
|
Stressmarq |
0.1mg |
EUR 478.8 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 633. |
Test Assays information
Monoclonal TBP monoclonal antibody |
|
APR13720G |
Leading Biology |
0.1ml |
EUR 633.6 |
|
Description: A Monoclonal antibody against Human TBP monoclonal. The antibodies are raised in Mouse. This antibody is applicable in WB |
Monoclonal EZH2 monoclonal antibody |
|
AMM00030G |
Leading Biology |
0.05mg |
EUR 633.6 |
|
Description: A Monoclonal antibody against Human EZH2 monoclonal. The antibodies are raised in Mouse. |
Monoclonal Rsf1 monoclonal antibody |
|
AMM07673G |
Leading Biology |
0.05mg |
EUR 633.6 |
|
Description: A Monoclonal antibody against Human Rsf1 monoclonal. The antibodies are raised in Mouse. This antibody is applicable in WB and IF, IP |
Monoclonal Rsf1 monoclonal antibody |
|
AMM07674G |
Leading Biology |
0.1ml |
EUR 633.6 |
|
Description: A Monoclonal antibody against Human Rsf1 monoclonal. The antibodies are raised in Mouse. This antibody is applicable in WB and IF, IP |
Monoclonal SirT1 monoclonal antibody |
|
APR09951G |
Leading Biology |
0.05mg |
EUR 580.8 |
|
Description: A Monoclonal antibody against Human SirT1 monoclonal. The antibodies are raised in Mouse. This antibody is applicable in WB |
Monoclonal SirT1 monoclonal antibody |
|
APR09952G |
Leading Biology |
0.1ml |
EUR 580.8 |
|
Description: A Monoclonal antibody against Human SirT1 monoclonal. The antibodies are raised in Mouse. This antibody is applicable in WB |
Monoclonal HDAC2 monoclonal antibody |
|
AMM00031G |
Leading Biology |
0.05mg |
EUR 633.6 |
|
Description: A Monoclonal antibody against Human HDAC2 monoclonal. The antibodies are raised in Mouse. This antibody is applicable in WB and IF |
Cytomegalovirus / CMV Early Antigen mouse monoclonal antibody, clone 1/42, Purified |
|
AM05468PU-N |
Origene Technologies GmbH |
200 µg |
Ask for price |
Monoclonal ER alpha monoclonal antibody |
|
AMM00027G |
Leading Biology |
0.1ml |
EUR 633.6 |
|
Description: A Monoclonal antibody against Human ER alpha monoclonal. The antibodies are raised in Mouse. This antibody is applicable in WB, IC, E, IP, GS |
Monoclonal ER alpha monoclonal antibody |
|
AMM00028G |
Leading Biology |
0.05mg |
EUR 633.6 |
|
Description: A Monoclonal antibody against Human ER alpha monoclonal. The antibodies are raised in Mouse. This antibody is applicable in WB |
Monoclonal RbAp 46/48 monoclonal antibody |
|
AMM00032G |
Leading Biology |
0.1ml |
EUR 580.8 |
|
Description: A Monoclonal antibody against Human RbAp 46/48 monoclonal. The antibodies are raised in Mouse. This antibody is applicable in WB |
Monoclonal RbAp 46/48 monoclonal antibody |
|
AMM00033G |
Leading Biology |
0.05mg |
EUR 580.8 |
|
Description: A Monoclonal antibody against Human RbAp 46/48 monoclonal. The antibodies are raised in Mouse. This antibody is applicable in WB |
Cytomegalovirus / CMV Late Antigen (65 kDa) mouse monoclonal antibody, clone 0896, Purified |
|
AM05719PU-N |
Origene Technologies GmbH |
100 µg |
Ask for price |
Cytomegalovirus / CMV Late Antigen (65 kDa) mouse monoclonal antibody, clone 981, Purified |
|
BM3129 |
Origene Technologies GmbH |
1 mg |
Ask for price |