Cmv Monoclonal

Monoclonal PP2A alpha and beta Antibody

AMM03147G 0.1ml
EUR 580.8
Description: A Monoclonal antibody against Human PP2A alpha and beta. The antibodies are raised in Mouse. This antibody is applicable in WB, IP

Cytomegalovirus Monoclonal Laboratories manufactures the cmv monoclonal reagents distributed by Genprice. The Cmv Monoclonal reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact cytomegalovirus monoclonal. Other Cmv products are available in stock. Specificity: Cmv Category: Monoclonal

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 423.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 480
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 390.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 488.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 565.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 594.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 633.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 655.

Test Assays information

Mouse Anti-CMV ICP8 Monoclonal antibody, cloneKG573

CABT-RM197 500 µg
EUR 1092

Mouse Anti-CMV IE1 Monoclonal antibody, cloneRQG538

CABT-RM198 500 µg
EUR 1092

Mouse Anti-CMV ICP22 Monoclonal antibody, cloneCDC67

CABT-RM195 100 µg
EUR 788.4

Mouse Anti-CMV ICP36 Monoclonal antibody, clone366C0

CABT-RM196 100 µg
EUR 788.4

Mouse Anti-CMV UL83 Monoclonal antibody, cloneTQU367

CABT-RM199 500 µg
EUR 1092

Monoclonal TNFSF18 Antibody (monoclonal), Clone: 2E11

AMM04221G 0.1mg
EUR 580.8
Description: A Monoclonal antibody against Human TNFSF18 (monoclonal). The antibodies are raised in mouse and are from clone 2E11. This antibody is applicable in WB, E

POLR2A (monoclonal) (M01AA) Mouse Monoclonal Antibody

E10G34376 100 μl
EUR 275
Description: Biotin-Conjugated, FITC-Conjugated , AF350 Conjugated , AF405M-Conjugated ,AF488-Conjugated, AF514-Conjugated ,AF532-Conjugated, AF555-Conjugated ,AF568-Conjugated , HRP-Conjugated, AF405S-Conjugated, AF405L-Conjugated , AF546-Conjugated, AF594-Conjugated , AF610-Conjugated, AF635-Conjugated , AF647-Conjugated , AF680-Conjugated , AF700-Conjugated , AF750-Conjugated , AF790-Conjugated , APC-Conjugated , PE-Conjugated , Cy3-Conjugated , Cy5-Conjugated , Cy5.5-Conjugated , Cy7-Conjugated Antibody

Monoclonal C3 Antibody (monoclonal) (M01), Clone: 5F9

APG03027G 0.1mg
EUR 580.8
Description: A Monoclonal antibody against Human C3 (monoclonal) (M01). The antibodies are raised in mouse and are from clone 5F9. This antibody is applicable in WB and IHC, E

Monoclonal SRF Antibody (monoclonal) (M03), Clone: 10

AMM04135G 0.1mg
EUR 580.8
Description: A Monoclonal antibody against Human SRF (monoclonal) (M03). The antibodies are raised in mouse and are from clone 10. This antibody is applicable in WB, E

Monoclonal T Antibody (monoclonal) (M01), Clone: 5H8

AMM04163G 0.1mg
EUR 580.8
Description: A Monoclonal antibody against Human T (monoclonal) (M01). The antibodies are raised in mouse and are from clone 5H8. This antibody is applicable in WB, E

Monoclonal T Antibody (monoclonal) (M02), Clone: 5C5

AMM04164G 0.1mg
EUR 580.8
Description: A Monoclonal antibody against Human T (monoclonal) (M02). The antibodies are raised in Mouse and are from clone 5C5. This antibody is applicable in WB, E

Monoclonal ESD Antibody (monoclonal) (M01), Clone: 10

AMM04445G 0.1mg
EUR 580.8
Description: A Monoclonal antibody against Human ESD (monoclonal) (M01). The antibodies are raised in mouse and are from clone 10. This antibody is applicable in WB, E

Monoclonal FH Antibody (monoclonal) (M09), Clone: 3E8

AMM04544G 0.1mg
EUR 580.8
Description: A Monoclonal antibody against Human FH (monoclonal) (M09). The antibodies are raised in mouse and are from clone 3E8. This antibody is applicable in WB and IHC, E

Monoclonal GPT Antibody (monoclonal) (M04), Clone: M1

AMM05205G 0.1mg
EUR 580.8
Description: A Monoclonal antibody against Human GPT (monoclonal) (M04). The antibodies are raised in mouse and are from clone M1. This antibody is applicable in E

Monoclonal ACD Antibody (monoclonal) (M02), Clone: S1

AMM03232G 0.1mg
EUR 580.8
Description: A Monoclonal antibody against Human ACD (monoclonal) (M02). The antibodies are raised in mouse and are from clone S1. This antibody is applicable in WB, IHC and IF, IP, E

Monoclonal CA1 Antibody (monoclonal) (M02), Clone: M2

AMM03310G 0.1mg
EUR 580.8
Description: A Monoclonal antibody against Human CA1 (monoclonal) (M02). The antibodies are raised in mouse and are from clone M2. This antibody is applicable in WB, E

Monoclonal CA1 Antibody (monoclonal) (M05), Clone: M1

AMM03311G 0.05mg
EUR 580.8
Description: A Monoclonal antibody against Human CA1 (monoclonal) (M05). The antibodies are raised in mouse and are from clone M1. This antibody is applicable in WB, IP, E