Cmv Monoclonal
Monoclonal PP2A alpha and beta Antibody |
|||
| AMM03147G | Leading Biology | 0.1ml | EUR 580.8 |
|
Description: A Monoclonal antibody against Human PP2A alpha and beta. The antibodies are raised in Mouse. This antibody is applicable in WB, IP |
|||
Cytomegalovirus Monoclonal Laboratories manufactures the cmv monoclonal reagents distributed by Genprice. The Cmv Monoclonal reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact cytomegalovirus monoclonal. Other Cmv products are available in stock. Specificity: Cmv Category: Monoclonal
Monoclonal antibody for SUR1 and SUR2B |
||
| Stressmarq | 0.1mg | EUR 471.6 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Alkaline Phosphatase. |
||
Monoclonal antibody for SUR1 and SUR2B |
||
| Stressmarq | 0.1mg | EUR 477.6 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC. |
||
Monoclonal antibody for SUR1 and SUR2B |
||
| Stressmarq | 0.1mg | EUR 564 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC/Cy7. |
||
Monoclonal antibody for SUR1 and SUR2B |
||
| Stressmarq | 0.1mg | EUR 474 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Biotin. |
||
Monoclonal antibody for SUR1 and SUR2B |
||
| Stressmarq | 0.1mg | EUR 495.6 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 350. |
||
Monoclonal antibody for SUR1 and SUR2B |
||
| Stressmarq | 0.1mg | EUR 482.4 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 405. |
||
Monoclonal antibody for SUR1 and SUR2B |
||
| Stressmarq | 0.1mg | EUR 470.4 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 488. |
||
Monoclonal HD Antibody (monoclonal) (M11), Clone: 3F1 |
|||
| APR12333G | Leading Biology | 0.1mg | EUR 580.8 |
|
Description: A Monoclonal antibody against Human HD (monoclonal) (M11). The antibodies are raised in mouse and are from clone 3F1. This antibody is applicable in WB and IHC, E |
|||
Monoclonal MB Antibody (monoclonal) (M04), Clone: 3F7 |
|||
| APR08355G | Leading Biology | 0.1mg | EUR 580.8 |
|
Description: A Monoclonal antibody against Human MB (monoclonal) (M04). The antibodies are raised in Mouse and are from clone 3F7. This antibody is applicable in WB |
|||
Monoclonal MT Antibody (monoclonal) (M01), Clone: 2F2 |
|||
| APR08559G | Leading Biology | 0.1mg | EUR 580.8 |
|
Description: A Monoclonal antibody against Human MT (monoclonal) (M01). The antibodies are raised in mouse and are from clone 2F2. This antibody is applicable in WB and IHC, E |
|||
Monoclonal AES Antibody (monoclonal) (M02), Clone: 10 |
|||
| APR14861G | Leading Biology | 0.1mg | EUR 580.8 |
|
Description: A Monoclonal antibody against Human AES (monoclonal) (M02). The antibodies are raised in mouse and are from clone 10. This antibody is applicable in E |
|||
Monoclonal CHP Antibody (monoclonal) (M02), Clone: S2 |
|||
| APR15427G | Leading Biology | 0.1mg | EUR 580.8 |
|
Description: A Monoclonal antibody against Human CHP (monoclonal) (M02). The antibodies are raised in mouse and are from clone S2. This antibody is applicable in WB, E |
|||
Monoclonal AK1 Antibody (monoclonal) (M08), Clone: M1 |
|||
| APG01638G | Leading Biology | 0.1mg | EUR 580.8 |
|
Description: A Monoclonal antibody against Human AK1 (monoclonal) (M08). The antibodies are raised in mouse and are from clone M1. This antibody is applicable in WB and IF, E |
|||
Monoclonal CBS Antibody (monoclonal) (M01), Clone: 30 |
|||
| APG02460G | Leading Biology | 0.1mg | EUR 580.8 |
|
Description: A Monoclonal antibody against Human CBS (monoclonal) (M01). The antibodies are raised in mouse and are from clone 30. This antibody is applicable in WB and IHC, IP |
|||
Monoclonal C3 Antibody (monoclonal) (M01), Clone: 5F9 |
|||
| APG03027G | Leading Biology | 0.1mg | EUR 580.8 |
|
Description: A Monoclonal antibody against Human C3 (monoclonal) (M01). The antibodies are raised in mouse and are from clone 5F9. This antibody is applicable in WB and IHC, E |
|||
Monoclonal LEP Antibody (monoclonal) (M02), Clone: M1 |
|||
| APR08190G | Leading Biology | 0.1mg | EUR 580.8 |
|
Description: A Monoclonal antibody against Human LEP (monoclonal) (M02). The antibodies are raised in mouse and are from clone M1. This antibody is applicable in E |
|||
Monoclonal SRF Antibody (monoclonal) (M03), Clone: 10 |
|||
| AMM04135G | Leading Biology | 0.1mg | EUR 580.8 |
|
Description: A Monoclonal antibody against Human SRF (monoclonal) (M03). The antibodies are raised in mouse and are from clone 10. This antibody is applicable in WB, E |
|||
Monoclonal T Antibody (monoclonal) (M01), Clone: 5H8 |
|||
| AMM04163G | Leading Biology | 0.1mg | EUR 580.8 |
|
Description: A Monoclonal antibody against Human T (monoclonal) (M01). The antibodies are raised in mouse and are from clone 5H8. This antibody is applicable in WB, E |
|||
Monoclonal T Antibody (monoclonal) (M02), Clone: 5C5 |
|||
| AMM04164G | Leading Biology | 0.1mg | EUR 580.8 |
|
Description: A Monoclonal antibody against Human T (monoclonal) (M02). The antibodies are raised in Mouse and are from clone 5C5. This antibody is applicable in WB, E |
|||
Monoclonal ESD Antibody (monoclonal) (M01), Clone: 10 |
|||
| AMM04445G | Leading Biology | 0.1mg | EUR 580.8 |
|
Description: A Monoclonal antibody against Human ESD (monoclonal) (M01). The antibodies are raised in mouse and are from clone 10. This antibody is applicable in WB, E |
|||
Monoclonal FH Antibody (monoclonal) (M09), Clone: 3E8 |
|||
| AMM04544G | Leading Biology | 0.1mg | EUR 580.8 |
|
Description: A Monoclonal antibody against Human FH (monoclonal) (M09). The antibodies are raised in mouse and are from clone 3E8. This antibody is applicable in WB and IHC, E |
|||
Monoclonal GPT Antibody (monoclonal) (M04), Clone: M1 |
|||
| AMM05205G | Leading Biology | 0.1mg | EUR 580.8 |
|
Description: A Monoclonal antibody against Human GPT (monoclonal) (M04). The antibodies are raised in mouse and are from clone M1. This antibody is applicable in E |
|||
Monoclonal TNFSF18 Antibody (monoclonal), Clone: 2E11 |
|||
| AMM04221G | Leading Biology | 0.1mg | EUR 580.8 |
|
Description: A Monoclonal antibody against Human TNFSF18 (monoclonal). The antibodies are raised in mouse and are from clone 2E11. This antibody is applicable in WB, E |
|||
Monoclonal NDN Antibody (monoclonal) (M02), Clone: 1B3 |
|||
| AMM06580G | Leading Biology | 0.1mg | EUR 580.8 |
|
Description: A Monoclonal antibody against Human NDN (monoclonal) (M02). The antibodies are raised in mouse and are from clone 1B3. This antibody is applicable in WB, IHC and IF, E |
|||